Everything below concerns evidence gap. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-07-25. Where a claim depends on a specific study, the study is described rather than over-claimed.
Direct human evidence is scarce. One trial in ulcerative colitis delivered the compound by enema and produced limited publicly reported results without a clear benefit. The compound is not an approved medicine in most jurisdictions. In many markets it is sold as a research chemical; in others it falls under prescription or controlled categories. Regulators have not confirmed any claimed medical use, and product labels rarely undergo premarket review.
Most published reports describe experiments in rodents rather than in people. These studies examine outcomes in tendons, ligaments, bone, stomach lining, and intestinal tissue. In rat and mouse models, a frequently reported effect is faster healing or reduced damage. Sample sizes are usually small, and a substantial share of the work originates from a small number of research groups. Independent replication is limited, so how far the findings extend to humans remains an open question.
Proposed mechanisms in the literature involve the nitric oxide system, vascular endothelial growth factor signaling, and epidermal growth factor receptor pathways. Some studies report changes in blood vessel formation or in inflammatory mediators, while others describe interactions with nervous tissue. Much of this evidence rests on molecular markers in cultured cells or animal models. Whether the same pathways operate the same way in humans has not been established. Authors therefore tend to describe mechanisms as hypothetical rather than settled.
Identity and purity are checked with standard peptide techniques. Reversed-phase high-performance liquid chromatography separates the main peak from closely related impurities and yields a percentage purity. Mass spectrometry confirms that the measured mass matches the theoretical value. Amino acid analysis offers an independent check on overall composition. These analytical methods characterize the material itself and reveal nothing about how it behaves in a living system.
In its common research form the peptide is supplied as a lyophilized powder. It dissolves readily in water and in typical aqueous buffers, which simplifies preparation of working solutions. Laboratories usually prepare small aliquots instead of one large volume. The dry material appears as a white to off-white solid with no distinctive odor. Bulk quantities are typically shipped in sealed vials.
Lyophilized material is generally kept cold, commonly at minus twenty degrees Celsius, and shielded from moisture and light. Solutions are less stable than the dry powder, so repeated freeze-thaw cycles are avoided by splitting the material into single-use portions. Published stability data for this particular peptide are limited, which means suggested hold times should be read as provisional. Long-term refrigeration of reconstituted solutions is not well supported by available evidence.
| Property | Value | Notes |
|---|---|---|
| Main study model | Rodents, rats and mice | Underpins most of the published data |
| Common routes in studies | Subcutaneous, intraperitoneal, oral | Varies with the experimental design |
| Common analytical method | Reversed-phase HPLC, LC-MS | Used for identity and purity checks |
| Human evidence base | Small | Few trials reported, with limited findings |
| Regulatory status | Varies by jurisdiction | Not an approved medicine in most places |
Outside laboratory supply channels, the peptide is sold as a research chemical, a category that carries no requirement to demonstrate purity, identity, or freedom from contamination. Because it is not an approved medicine, products labeled BPC-157 sit in a regulatory gap in many countries, and actual content may differ from the label. Sports organizations list it among prohibited substances, so its presence in an athlete's sample can produce a doping finding regardless of how the material was obtained.
BPC-157 is a synthetic peptide of fifteen amino acids, written as GEPPPGKPADDAGLV, whose sequence matches part of a larger protein identified in human gastric juice. That parent protein was described in stomach-secretion research, and the fifteen-residue fragment was named body protection compound, which gives the peptide its common label. Material used in experiments is produced by solid-phase peptide synthesis rather than extracted from tissue. The reported molecular weight is about 1419 daltons, and the chain contains several proline residues, a feature that appears in discussions of its resistance to enzymatic breakdown.
Most published findings come from rodent models, where the peptide has been examined in wound-healing, gastrointestinal-lesion, tendon, and vascular-injury preparations. A smaller number of early human studies have been reported, chiefly in inflammatory bowel conditions, but the public record is short and has not led to marketing approval in the United States or the European Union. Reviewers therefore classify the compound as investigational, and whether animal results carry over to people remains an open question rather than a settled one.
Human data are far more limited than animal data. A small number of clinical reports exist, generally with few participants and without the randomization or blinding expected in later-phase trials. No large, independently replicated human trial has appeared in the indexed peer-reviewed literature. Statements about effects in people therefore rest on extrapolation from animal work rather than on direct evidence, and the strength of that extrapolation remains an open question rather than a settled matter.
Proposed mechanisms include interaction with the nitric oxide system, modulation of growth factor signaling, and effects on blood vessel formation. None of these has been established as the primary mode of action, and some proposed pathways rest on indirect measurements. Whether the reported effects depend on a specific receptor has not been determined. Stability in gastric acid, unusual for a peptide of this size, is also reported in animal work, but the reason for it is not firmly established.
Published studies on BPC-157 are dominated by animal models. Commonly used endpoints include healing of surgically induced lesions in the stomach, tendon-to-bone attachment after transection, and recovery from experimentally induced vascular or intestinal damage. Many of these reports come from a small number of research groups, and the peptide is often described as acting across a wide range of tissue types. That breadth is itself a point of discussion, since one molecule influencing many unrelated systems is unusual.
A freeze-dried sample is generally the most stable form and is commonly held at minus twenty degrees Celsius or lower for long-term keeping, with brief transfers at room temperature. The solid is hygroscopic, so vials are warmed to ambient temperature before opening to prevent condensation from degrading the contents. Light exposure and repeated temperature cycling are both avoided in routine handling. Storage over a desiccant is a common laboratory practice that limits moisture uptake during repeated access.
Once dissolved, the material is considerably less stable than the dry solid. Aqueous solutions are usually kept cold and used within a short window, and neutral or mildly acidic buffers are preferred over strongly alkaline conditions. Freeze-thaw cycles promote aggregation and loss of material to container surfaces, so dividing a batch into single-use aliquots is standard. Adsorption to plastic and glass can lower the measured concentration, meaning solution strength may need rechecking before an experiment.
Most published work on BPC-157 consists of preclinical studies, including rodent models of tissue injury, gastrointestinal lesions, and vascular or tendon damage, together with in vitro cell assays. Reviews frequently note that the mechanisms proposed in these papers remain incompletely characterised and that findings have not been confirmed in large randomised human trials. The compound is widely sold as a research chemical rather than a licensed medicine, and labels commonly carry a statement that it is not for human use. Whether any of the reported animal effects translate to humans is an open question rather than an established result.
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
BPC-157 is a synthetic peptide composed of fifteen amino acid residues, with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Its name derives from body protection compound, a term used for a protein fraction identified in human gastric juice. Researchers in Zagreb first reported the pentadecapeptide in the early 1990s and described it as a stable fragment of that larger protein. The compound is also catalogued as PL 14736 and, in some commercial contexts, as bepecin. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
In other countries, such as Egypt, it is legal to use and purchase tobacco products regardless of age. Germany raised the purchase age from 16 to 18 on September 1, 2007. Some police departments in the United States occasionally send an underaged teenager into a store where cigarettes are sold, and have the teen attempt to purchase cigarettes, with their own or no ID. If the vendor then completes the sale, the store is issued a fine. Similar enforcement practices are regularly performed by Trading Standards officers in the UK, and by equivalents in Israel and the Republic of Ireland.
In its simplest form, nutrient-enriched water is pumped into containers with plants in a growing medium such as Expanded clay aggregate At regular intervals, a simple timer causes a pump to fill the containers with nutrient solution, after which the solution drains back down into the reservoir. This keeps the medium regularly flushed with nutrients and air.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
diphtheriae infection (Barcoo rot, diphtheric desert sore, septic sore, Veldt sore) Cutaneous group B streptococcal infection Cutaneous Pasteurella hemolytica infection Cutaneous Streptococcus iniae infection Dermatitis gangrenosa (gangrene of the skin) Ecthyma Ecthyma gangrenosum Ehrlichiosis ewingii infection Elephantiasis nostras Endemic typhus (murine typhus) Epidemic typhus (epidemic louse-borne typhus) Erysipelas (ignis sacer, Saint Anthony's fire) Erysipeloid of Rosenbach Erythema marginatum Erythrasma External otitis (otitis externa, swimmer's ear) Felon Flea-borne spotted fever Flinders Island spotted fever Flying squirrel typhus Folliculitis Fournier gangrene (Fournier gangrene of the penis or scrotum) Furunculosis (boil) Gas gangrene (clostridial myonecrosis, myonecrosis) Glanders (equinia, farcy, malleus) Gonococcemia (arthritis–dermatosis syndrome, disseminated gonococcal infection) Gonorrhea (clap) Gram-negative folliculitis Gram-negative toe web infection Granuloma inguinale (Donovanosis, granuloma genitoinguinale, granuloma inguinale tropicum, granuloma venereum, granuloma venereum genitoinguinale, lupoid form of groin ulceration, serpiginous ulceration of the groin, ulcerating granuloma of the pudendum, ulcerating sclerosing granuloma) Green nail syndrome Group JK Corynebacterium sepsis Haemophilus influenzae cellulitis Helicobacter cellulitis Hospital furunculosis Hot tub folliculitis (Pseudomonas aeruginosa folliculitis) Human granulocytotropic anaplasmosis Human monocytotropic ehrlichiosis Impetigo contagiosa Japanese spotted fever Leptospirosis (Fort Bragg fever, pretibial fever, Weil's disease) Listeriosis Ludwig's angina Lupoid sycosis Lyme disease (Afzelius' disease, Lyme borreliosis) Lymphogranuloma venereum (climatic bubo, Durand–Nicolas–Favre disease, lymphogranuloma inguinale, poradenitis inguinale, strumous bubo) Malakoplakia (malacoplakia) Mediterranean spotted fever (Boutonneuse fever) Melioidosis (Whitmore's disease) Meningococcemia Missouri Lyme disease Mycoplasma infection Necrotizing fasciitis (flesh-eating bacteria syndrome) Neonatal toxic shock-like exanthematous disease Nocardiosis Noma neonatorum North Asian tick typhus Ophthalmia neonatorum Oroya fever (Carrion's disease) Pasteurellosis Perianal cellulitis (perineal dermatitis, streptococcal perianal disease) Periapical abscess Pinta Pitted keratolysis (keratolysis plantare sulcatum, keratoma plantare sulcatum, ringed keratolysis) Plague Primary gonococcal dermatitis Pseudomonal pyoderma Pseudomonas hot-foot syndrome Pyogenic paronychia Pyomyositis Q fever Queensland tick typhus Rat-bite fever Recurrent toxin-mediated perineal erythema Rhinoscleroma Rickettsia aeschlimannii infection Rickettsialpox Rocky Mountain spotted fever Saber shin (anterior tibial bowing) Saddle nose Salmonellosis Scarlet fever Scrub typhus (Tsutsugamushi fever) Shigellosis Staphylococcal scalded skin syndrome (pemphigus neonatorum, Ritter's disease) Streptococcal intertrigo Superficial pustular folliculitis (impetigo of Bockhart, superficial folliculitis) Sycosis vulgaris (barber's itch, sycosis barbae) Syphilid Syphilis (lues) Tick-borne lymphadenopathy Toxic shock syndrome (streptococcal toxic shock syndrome, streptococcal toxic shock-like syndrome, toxic streptococcal syndrome) Trench fever (five-day fever, quintan fever, urban trench fever) Tropical ulcer (Aden ulcer, jungle rot, Malabar ulcer, tropical phagedena) Tularemia (deer fly fever, Ohara's disease, Pahvant Valley plague, rabbit fever) Verruga peruana Vibrio vulnificus infection Yaws (bouba, frambösie, parangi, pian)
The ancient Indian sexual treatise Kama Sutra, written in Sanskrit, probably between the second and fourth centuries AD, divides men into three classes based on penis size: "hare" size (about 5–7 cm, or 2–3 inches, when erect), "bull" size (10–15 cm, or 4–6 inches), and "horse" size (18–20 cm, or 7–8 inches). The treatise also divides women's vaginas into three sizes ("deer", "mare", and "elephant") and advises that a man match the size of the vagina of the woman he is having sex with to the size of his own penis. It also gives medically dubious advice on how to enlarge one's penis using wasp stings.
Sources: en.wikipedia.org
16th Airborne Division, under the command of Major-General Robert E. "Roy" Urquhart 42nd (Lancashire) Infantry Division 43rd (Wessex) Infantry Division 44th (Home Counties) Infantry Division 49th (West Riding & North Midland) Armoured Division (49th (West Riding and North Midland) Division/District in 1961) 50th (Northumbrian) Infantry Division (50th Northumbrian District by 1966) 51st/52nd (Lowland) Infantry Division 53rd (Welsh) Infantry Division 56th (London) Armoured Division 52nd (Lowland) Division was re-established as a tenth, 'mixed' division in March 1950. Three corps were planned to supervise the divisions. Two appear to have been actually formed, XXI (Northern) Corps, and XXIII (Southern) Corps. The planned 22nd Corps in Western Command was never formed although its sign, 'XXII in gold on blue with a red edge' was recorded in a Western Command letter to the War Office of 3rd July 1947 to be found in National Archives file WO32/18819. The Territorials also provided much of the Anti-aircraft warfare defence for the United Kingdom until 1956. In that year, Anti-Aircraft Command and 15 anti-aircraft regiments of the Royal Artillery were disbanded, with nine others passing into "suspended animation" as new English Electric Thunderbird Surface to Air Missile units replaced them. On 20 December 1955, the Secretary of State for War informed the House of Commons that the armoured divisions and the 'mixed' division were to be converted to infantry, and the 16th Airborne Division reduced to a parachute brigade group.
Selenocysteine synthesis occurs on a specialized tRNA, which also functions to incorporate it into nascent polypeptides. The primary and secondary structure of selenocysteine-specific tRNA, tRNASec, differ from those of standard tRNAs in several respects, most notably in having an 8-base-pair (bacteria) or 10-base-pair (eukaryotes) acceptor stem, a long variable region arm, and substitutions at several well-conserved base positions. The selenocysteine tRNAs are initially charged with serine by seryl-tRNA ligase, but the resulting Ser-tRNASec is not used for translation because it is not recognised by the normal translation elongation factor (EF-Tu in bacteria, eEF1A in eukaryotes).
=== Safety === MNPs may cause skin irritation on people with sensitive skin. Majority of studies show that MNPs do not irritate the skin. Especially for hollow MNPs, the not so stiff needles may cause unnecessary puncture of the skin outer layer, and may cause trauma to the skin and restricting the performance and flow of the drugs to the body.
== Methods == Quantitative chemical analysis is a key part of environmental chemistry, since it provides the data that frame most environmental studies. Common analytical techniques used for quantitative determinations in environmental chemistry include classical wet chemistry, such as gravimetric, titrimetric and electrochemical methods. More sophisticated approaches are used in the determination of trace metals and organic compounds. Metals are commonly measured by atomic spectroscopy and mass spectrometry: Atomic Absorption Spectrophotometry (AAS) and Inductively Coupled Plasma Atomic Emission (ICP-AES) or Inductively Coupled Plasma Mass Spectrometric (ICP-MS) techniques. Organic compounds, including PAHs, are commonly measured also using mass spectrometric methods, such as Gas chromatography-mass spectrometry (GC/MS) and Liquid chromatography-mass spectrometry (LC/MS). Tandem Mass spectrometry MS/MS and High Resolution/Accurate Mass spectrometry HR/AM offer sub part per trillion detection. Non-MS methods using GCs and LCs having universal or specific detectors are still staples in the arsenal of available analytical tools. Radioactive materials are assayed by particle counters and scintillation counter. Bioassays and immunoassays are utilized for toxicity evaluations of chemical effects on various organisms. Polymerase Chain Reaction PCR is able to identify species of bacteria and other organisms through specific DNA and RNA gene isolation and amplification and is showing promise as a valuable technique for identifying environmental microbial contamination.
==== Regional air hubs ==== UPS has five large regional air hubs in the United States, located in Ontario, California; Dallas, Texas; Rockford, Illinois; Philadelphia, Pennsylvania; and Atlanta, Georgia. These hubs serve as centers for sorting, transfer and delivery of packages.
Sources: en.wikipedia.org
Animal experiments form the bulk of the published record. Rodent models of tendon, ligament, bone, and gut injury are the most common designs. Controlled human trials are rare, which limits confidence in any clinical claim.
They are best described as working hypotheses. Supporting data come mainly from cell cultures and animal tissue, using markers such as growth factors and inflammatory signals. Confirmatory human studies have not been reported.
Status depends on the country. In some places it is treated as a research chemical available without a prescription, while elsewhere it falls under prescription or controlled rules. It holds no general marketing approval as a therapeutic product.
Dry powder is commonly held at minus twenty degrees Celsius, desiccated and away from light. Cold storage slows degradation of the lyophilized material.